primary polyclonal rabbit antibody against runx1  (Boster Bio)

Journal: International journal of molecular medicine

Article Title: Brain death induces the alteration of liver protein expression profiles in rabbits.

doi: 10.3892/ijmm.2014.1806

Figure Lengend Snippet: Figure 5. Re‑identification of altenation of runt‑related transcription factor 1 (RUNX1) proteins by immunohistochemistry and western blot analysis. (A) Representative images (x100) of immunohistochemical analysis of (a‑d) control samples and (e‑h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β‑actin as an internal control. A significant decrease in a time‑dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.

Article Snippet: The membrane was then blocked with 5% non-fat dry milk overnight and probed with primary rabbit polyclonal antibody against RUNX1 (1:500, Boster Biological Engineering, Co., Ltd.).

Techniques: Immunohistochemistry, Western Blot, Immunohistochemical staining, Control, Expressing, Staining

Journal: International journal of molecular medicine

Article Title: Brain death induces the alteration of liver protein expression profiles in rabbits.

doi: 10.3892/ijmm.2014.1806

Figure Lengend Snippet: Figure 4. Identification of alteration of runt‑related transcription factor 1 (RUNX1) protein expression by MALDI‑TOF/TOF tandem mass spectrometry. Acquired spectra were searched against a Mascot search engine based on the Swiss‑Prot protein database. MS/MS spectrum of the precursor ion with m/z 2425.2 for peptide 335ILPPCTNASTGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY386 with corresponding peak values was identi fied as RUNX1. Inset is the Swiss‑Prot protein score from the Swiss‑Prot database.

Article Snippet: The membrane was then blocked with 5% non-fat dry milk overnight and probed with primary rabbit polyclonal antibody against RUNX1 (1:500, Boster Biological Engineering, Co., Ltd.).

Techniques: Expressing, Mass Spectrometry, Tandem Mass Spectroscopy

Journal:

Article Title: Mitotic partitioning and selective reorganization of tissue-specific transcription factors in progeny cells

doi: 10.1073/pnas.2533076100

Figure Lengend Snippet: Runx proteins partition equivalently in progeny cells following cell division. Jurkat lymphoma cells (A) or ROS 17/2.8 osteosarcoma cells (B) were subjected to in situ immunofluorescence microscopy. Runx1 and Runx2 were detected by rabbit polyclonal antibodies followed by the incubation of cells with secondary antibodies conjugated with Alexa 488 fluorochrome. Both Runx1 and Runx2 were distributed at punctate subnuclear foci throughout the interphase nucleus (Upper). A quantitative image analysis was applied to determine the relative levels of Runx in nuclei of the telophase cells (n = 10; Lower). We defined a PC that reflects the ratio of integrated signal intensities between progeny nuclei. Both Runx proteins exhibited a PC equivalent to that of DNA, demonstrating that these factors are equally segregated in progeny cells after cell division. Student's t test was performed to assess the significance of observed differences.

Article Snippet: Antibodies and their dilutions used were as follows: rabbit polyclonal antibodies against Runx2 [1:200; EMD Biosciences (Oncogene), San Diego], rabbit polyclonal antibody raised against Runx1 (1:25; Geneka Biotechnology, Montreal), tetra-acetylated-histone H4 (1:400; 06-866, Upstate Biotechnology, Lake Placid, NY), p300 (1:400; Santa Cruz Biotechnology), and mouse monoclonal antibody against SC35 (1:200; Sigma–Aldrich).

Techniques: In Situ, Immunofluorescence, Microscopy, Incubation

Journal:

Article Title: The E2A-HLF Oncoprotein Activates Groucho -Related Genes and Suppresses Runx1

doi: 10.1128/MCB.21.17.5935-5945.2001

Figure Lengend Snippet: Downregulation of expression of the RUNX1 gene induced by E2A-HLF. Northern blot analysis was performed on poly(A)+ RNA (1 μg per lane) prepared from FL5.12 cells expressing the indicated cDNAs under the control of a zinc-regulated metallothionein promoter. Cells were cultured in the presence or absence of zinc (100 μM) and IL-3 as described in the legend to Fig. ​Fig.1.1. The blot was hybridized with the RUNX1 or Gapdh cDNA probe as indicated. Mobilities of the 18S and 28S rRNAs are shown.

Article Snippet: A rabbit polyclonal antibody against Runx1 (AML1/RHD; Ab-2) was obtained from Calbiochem, and a goat polyclonal antibody against actin (C-11) was obtained from Santa Cruz Biotechnology.

Techniques: Expressing, Northern Blot, Cell Culture

Journal:

Article Title: The E2A-HLF Oncoprotein Activates Groucho -Related Genes and Suppresses Runx1

doi: 10.1128/MCB.21.17.5935-5945.2001

Figure Lengend Snippet: Time course of RUNX1 and Grg6 mRNA expression in E2A-HLF-transfected FL5.12 cells. (A) Total RNA was isolated at different time points after addition of zinc (100 μM) and hybridized with RUNX1, Grg6, and Gapdh antisense mRNA probes. GAPDH was used as an internal control. The protected RNA fragments (solid arrowheads) were separated by an 8% sequencing gel. Open arrowheads, RNA probes. (B) Immunoblot analysis of Runx1 in E2A-HLF-transfected FL5.12 cells. Extracts were prepared from cells stably transfected with either the pMT-CB6+ vector or the metallothionein promoter-regulated E2A-HLF construct after the cells were cultured in IL-3-containing medium for the indicated times in hours after the addition of 100 μM ZnSO4. The blot was immunoblotted with Runx1 rabbit antisera, HLF(C) rabbit antisera, and actin goat antisera (C11), respectively.

Article Snippet: A rabbit polyclonal antibody against Runx1 (AML1/RHD; Ab-2) was obtained from Calbiochem, and a goat polyclonal antibody against actin (C-11) was obtained from Santa Cruz Biotechnology.

Techniques: Expressing, Transfection, Isolation, Sequencing, Western Blot, Stable Transfection, Plasmid Preparation, Construct, Cell Culture

Journal:

Article Title: The E2A-HLF Oncoprotein Activates Groucho -Related Genes and Suppresses Runx1

doi: 10.1128/MCB.21.17.5935-5945.2001

Figure Lengend Snippet: Expression of RUNX1 and Grg6 in FL5.12 cells stably transfected with plasmids expressing E2A-HLF, TLE1, TLE2, and RDA3. Total RNA was isolated from cells with or without a 24-h incubation with zinc (100 μM) and was hybridized with RUNX1, Grg6, and Gapdh antisense RNA probes. Solid arrowheads, protected RNA fragments; open arrowheads, RNA probes.

Article Snippet: A rabbit polyclonal antibody against Runx1 (AML1/RHD; Ab-2) was obtained from Calbiochem, and a goat polyclonal antibody against actin (C-11) was obtained from Santa Cruz Biotechnology.

Techniques: Expressing, Stable Transfection, Transfection, Isolation, Incubation